SKU: 9355137261

IL-7 Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-7 Protein, HumanProduct Specification Species Human Synonyms Interleukin 7 Accession P13232 Amino Acid Sequence Asp26 His177 with C terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH Expression System HEK293 Molecular Weight 18 30 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU mg Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Interleukin-7
Accession P13232
Amino Acid Sequence

Asp26-His177 with C-terminal 6*His Tag

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Expression System HEK293
Molecular Weight 18-30 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 10 mM PBS, pH 7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9355137261

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 2254 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Excellent Kindergarten prep
Format: Paperback
My daughter is loving all of the learning exercises and has started feeling more confident heading in to Kindergarten.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
S
Verified Purchase
stephanie
West Palm Beach, US
★★★★★ 5
Excellent Summer Workbooks - Keeps Kids Engaged and Ready
Format: Paperback
These workbooks have been an absolute lifesaver for keeping my kids on track over the summer! I was looking for a resource that would help them retain what they learned and prepare for the next school year without feeling like a chore, and these deliver perfectly. What I particularly love is how well **organized they are by days**. This structure eliminates any guesswork and makes it incredibly easy to assign manageable chunks of work each day, which helps to **keep my kids consistently on track**. There's no overwhelm, just steady progress. The content is engaging, and it genuinely seems to reinforce key concepts in a fun way. We've had **absolutely no complaints** from the kids, which is a huge win for any summer learning material! I highly recommend these workbooks for any parent looking for a structured and effective way to bridge the academic gap during the summer break.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2025
C
Verified Purchase
Calista Ho
Waukegan, US
★★★★★ 5
Fun for my Kindergarteners!
Format: Paperback
This activity book is a fantastic, age-appropriate resource that makes summer learning both fun and effective for Kindergarteners transitioning to 1st grade! The pages are thoughtfully designed with easy-to-follow activities that keep young minds engaged while reinforcing essential skills. The addition of flashcards, stickers, and eBooks takes the learning experience to the next level, making practice feel like playtime. One of my favorite features is the encouragement of hands-on learning and movement through exciting fitness challenges—because learning shouldn't just be about worksheets! It turns what could be a boring review into an adventure filled with creativity and energy. This workbook truly helps bridge the summer gap while keeping kids motivated and excited for the next school year. A must-have for any little learner’s summer routine!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2025
B
Verified Purchase
Brittany Skinner
Omaha, US
★★★★★ 5
Recommend
Format: Paperback
Has been a great learning book
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
A
Verified Purchase
Anna Lauren Page
Whiting, US
★★★★★ 4
Teacher approved
Format: Paperback
Great review book to help bridge the learning between Kindergarten and 1st grade. Teacher approved!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2025

recommand products