SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1231 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stuck in Nova
Massapequa, US
★★★★★ 5
An amazing, if sometimes dark, memoir of work, solitude, and taking a pragmatic path in life.
Format: Hardcover
What do you do, when your only viable financial prospects are to move to even more remote, cold, dark and desolate land where you are part of a corporate mining operation dredging sands for valuable resources, living onsite in a company owned dormitory? Beaton recalls all this in her memoir of her post-university time, where she was faced with this decision to either live and work the oil sands, or face a life of financial bondage trying to pay back student loans, a decision we see many of her own countrymen face as their only viable means to survive. If you are familiar with Beaton's comic strip work, you'll see familiar reference to the genesis of it here, but Ducks is a far more serious graphic novel. Both engaging and often times bleak, Ducks gives a wonderful window into the reality of Canada's oil industry, and the humanity of the people, who are nothing more than cogs in a machine, that run it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2023
A
Verified Purchase
Agy Wilson
San Leandro, US
★★★★★ 5
What is NOT to love about Lynda Barry?
Format: Paperback
I’ve been reading Lynda Barry since the 80s and am currently at work on a graphic novel, that I’m writing and illustrating. I have always believed in learning from the best and Barry has always been a favorite, from the creativity, recall and connections she makes with her work as well as with me (and I assume her other readers as well). This book delves into the connections of words and images, how to conjure and connect, especially with the whole creative vibe. She works with young people and the pipeline to that cerebral communication is appreciated and thought provoking as well, as my work will be geared to a younger audience. This is for anyone who interested in the process of sequential art, creating comics, characters, connecting with creative elements, it’s also a visually stunning book (again, the nerd in me, loved all the cross-references with the visual and other, using calligraphic and other historic, formal art elements along with the more personal character, visual creations and exercises. Thought-provoking and image inducing, indeed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2020
C
Verified Purchase
Coffee&Camera
Chelsea, US
★★★★★ 5
Lynda Barry is Awesome
Format: Kindle
This book is fantastic if you want to make comics by yourself or with a classroom. Barry packs in loads of experience teaching and making art. Her style of drawing is simple and straight forward. She uses a great method that empowers the reader to make art and share it. I want to be half the teacher Barry is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2024
J
Verified Purchase
Jennifer Gumm
West Palm Beach, US
★★★★★ 5
Creative outlets!
Format: Paperback
I LOVE following the activities in this book. Perfect for anyone who wants to draw but thinks they can’t, great exercises and fun for those creative blocks when you want to be creative but just can’t get it flowing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2025
D
Verified Purchase
Do We Really Need So Much Stuff?
Carnegie, US
★★★★★ 5
This! Book! Rocks!
Format: Paperback
If you enjoy laughing, having fun with your friends and family, and doing cool stuff, you will love Lynda Barry's Making Comics. This is a thoughtful and complete recap of her live class at the University of Wisconsin, includes much of her substantial thought and philosophy on the role of image making in human evolution, and is full of her (and her students') amazing artwork; but it's also full of excessively FUN drawing exercises that are wonderful for sucky drawers as well as professional artists. We dig this book so bad!!! Best gift I've given myself in a million years!!!!!!!!!!!! Maybe I had a little bit forgotten how much I! Love! Lynda! Barry!!!!! So if you wish you could go move to Wisconsin and take her class like I do, instead just save the planet the extra greenhouse gases and get this book instead and do the class at your kitchen table with your friends!!! Maybe also order it from your local groovy independent bookstore so you can stick it to the man!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2020

recommand products