SKU: 5185189478

Human IL-10, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-10, His TagProduct Specification Species Human Accession P22301 Amino Acid Sequence SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 19. 6 kDa (Reducing) Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4

Product Specification


Species Human
Accession P22301
Amino Acid Sequence

SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 19.6 kDa (Reducing)
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

IL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5185189478

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 440 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BKossey929
Lexington, US
★★★★★ 5
This Pillow Is The Greatest!
Style: Standard - Tall
This pillow is amazing! It’s very pricey, but worth EVERY penny in both my opinion and my husband’s. My husband had been complaining about his old pillow for a while. I did some research and this pillow seemed to be the best of the best according to the reviews. But that price - yikes! I kept checking back and saw it was on sale and decided to take a chance. Bought it in the tall size (7.5 in.) and decided it would be his early birthday gift. The first night of him using it was AMAZING for both of us. He has snored like a freight train and will periodically stop breathing for 15-18 seconds throughout the night for the past 26 years that I know of. Immediately, his super loud snoring downgraded to a very low level of snoring. He said after the first night he fell asleep fast, did not wake up nearly as much and finally had no neck pain in the morning. He’s had it over a month now and says he can’t believe a pillow could make this big of a difference in his sleep quality. I can’t believe I don’t have to deal with his concert level snoring anymore. Plus, he no longer stops breathing for short intervals anymore! This pillow has been well worth the cost for us!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
D
Verified Purchase
Devin
Waukegan, US
★★★★★ 5
Great pillow, my neck is grateful!
Style: Standard - Tall
I am a combination sleeper and this pillow is comfortable in almost any direction I lay. Definitely a relief on my neck compared to my previous cervical type pillows.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
W
Verified Purchase
Wilson07
Bozeman, US
★★★★★ 4
Decent pillow; medium-firm; heavy
Style: King - Medium
I was looking to replace my old latex pillow from BBB. I have tried several but finding just the right one has been elusive. Although expensive, I was confident this would be THE one. Sadly, it isn't. For a latex pillow, this IS really nice. It is comfortable and solid latex - hard to find. It is medium-firm and has decent spring back. But for me, it doesn't have enough sink. It is actually too firm and I felt my neck was cranked all night (I am 5'6", 135#, side sleeper, ordered the 6.5" one). I do think the cooling Purple grid works pretty well but at the same time, I could feel the grid under my pillow case. The pillow is very heavy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
B
Verified Purchase
Bean Burrito
Boise, US
★★★★★ 1
It’s $30 to return and quickly STINKS from body heat
Style: Standard - Medium
Original review about $30 return below, but since it cost to return I gave it to my husband. He’s a hot sleeper so other than this pillow we’ve switched to all cotton, linen or wool bedding and it’s made a huge difference. (Polyester is plastic so it reflects your heat back to you and makes you sweat more and doesn’t breathe.) I truly would not have kept this pillow except $30 felt like a waste just to return and he got excited about it. So okay, it’s his. Well I’m the laundry queen in our household (he does all dishes) and I realized very quickly this pillow would need to be washed OFTEN. Like, once a week is NOT enough. Something about body heat and this material smells HORRIBLE. Washing it is obviously not easy, so I handwash the outer layer of the pillow with a very gentle soap (bought for silk). And then it has to hang dry. It doesn’t matter. I can clean it perfectly, no smell remaining whatsoever, but after two nights, it’s so strong I can smell it JUST STANDING NEAR THE BED. Look. I mentioned my hubs sleeps hot, sure. But he’s hygienic. This should not be such an issue. It’s never been an issue with any other pillows. The smell doesn’t even smell like him or like B.O. or anything. It’s awful and legitimately churns my stomach. But can I throw out the stupid $200 thing? Noooo. Now he’s attached. And I’m spending hours of my life each week washing it to keep from feeling sick sleeping near it at night. And to avoid having wasted $200. Hate this thing. DON’T BUY THIS STUPID PILLOW. Dropping from 2 stars to 1 Because of the smell. Original review: I thought I could buy this and see if the height would work for me. It didn’t, and pinched my neck instead. But now the *only* way to return it is to ship through UPS (not return to the UPS Store or Kohl’s or Whole Foods, which would be free). I was going to return it and try a different size, but such a high price just to *try* it is not worth it to me. I’ve returned much larger (defective) items in the past without hassle or cost (like an entire heavy duty garage shelf with broken pieces). Had I known, I would not have ordered in the first place, so I hope this saves someone else. As for the pillow itself, it was unique, but I couldn’t even really lay my head on it for more than a moment until I had let it air out for more than a week. It REEKED upon arrival. My husband said it smelled like ozone, and my brother compared it to the inside of an airplane. It burned my throat if I tried to lay on it for more than about 30 seconds at a time. Two and a half weeks later, the smell is still slightly there. So even if it was comfy for me, I would not keep this pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2025
A
Verified Purchase
Adelina
Charlottesville, US
★★★★★ 5
The best pillow for side and back sleeping
Style: King - Medium
Bought this pillow for my husband, he loves it. He is back sleeping and has been the best pillow so far. Worth the money. With buy one for me and my daughter. It’s a little pricey but when it comes to sleeping it’s worth the money.highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products