SKU: 33621356056

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33621356056

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 1520 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
ray
San Leandro, US
★★★★★ 3
Picture is misleading
Color: RYLCC-BLK
Great product! Good quality! The picture of the product is a little misleading as it looks like there are 2 tubes instead of one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2024
C
Verified Purchase
Charles Stein
Alexandria, US
★★★★★ 5
Perfect sized wrist-rest!
Size: Compact, Size: Compact
Great wrist-rest! Very squishy and feels comfortable & cool even after hours at the computer. The rubber gripper bottom is effective & it never shifts around for me. Also, love that it fits the length of my 75% keyboard & my boyfriends 60% Wooting 60HE keyboard perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
S
Verified Purchase
Sandra Miller
New York, US
★★★★★ 5
Very Pleased!
Size: Full Size
Review for: Cooling Gel Wrist Rest Pad -Full Size 18"- Memory Foam Palm Rest with Non-Slip Footpad - Ergonomic Design Wrist Support - Desk Keyboard Accessory Gaming Gear (Large-Full Size). I've had this for a week and I'm impressed! There is no skimping on quality, which is rare nowadays. It is made extremely well, solid yet soft. I love the feel of the outer cover. It's comfortable and stays in place. And let me add... I'm putting it to the test. I have a rolling over-bed/couch desk. It has a raised 1/4" lip around the top. I put this wrist-rest on top of that lip. So far there's not any wear across the bottom of this wrist-rest. And that's with me using it for my wrists... and my elbows. It far surpasses the last rest I bought. From my experience, many sellers slap the phrase "memory foam" on their products when they are not. That's NOT the case here. This rest immediately bounces back to its original shape. It's true memory foam! It's so comfortable that I forget it's there yet I enjoy the comfort immensely. Also, it has no smell. ***From my experience so far... I highly recommend this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2024
F
Verified Purchase
F & L
San Leandro, US
★★★★★ 4
Comfortable and functional, but beware of cardboard/mdf insert
Size: Compact
I’ve been using this wrist rest for a bit now, and for the most part, it does exactly what it’s supposed to do. It provides a comfortable amount of support for my wrists during long typing sessions, and the cooling gel aspect is definitely a nice touch that adds to the overall comfort. That said, there are a couple of drawbacks to keep in mind. The surface seems to attract dirt and grime pretty quickly, so you’ll need to wipe it down often to keep it looking clean. More importantly, the build quality of the base is disappointing. I believe its a cardboard inserted into the bottom, which snapped very easily when I was just barely bending it while cleaning it. It’s a shame because the rest of the product is great, but I really wish they had used a more rigid, durable material for the bottom instead of whatever this cardboard/mdf is. This is why I’m giving it 4 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
R
Verified Purchase
R. Jordan
Whiting, US
★★★★★ 5
Appears to be of high quality
Size: Full Size
Nice. I like the height. It's comfy and firm.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026

recommand products