SKU: 29978959269

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29978959269

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1862 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
T-gal
Birmingham, US
★★★★★ 5
So far, so good!
Finally! A toy my 55 pound, 18 month old puppy hasn’t destroyed in minutes, and one she actually LOVES playing with. It has a really cool bounce and she loves chasing it and it’s easy for her to grab and run back to me with. So glad it wasn’t another waste of money. My only suggestions are to make this in a fun color other than black, and to make other just as strong toys besides a donut (she already has 2 other donuts from different companies which surprisingly have weathered her jaws) and add a squeaker to one of these ultra strong toys. More than chasing the ball, she loves squeaking!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
M
Verified Purchase
Melissa j
West Palm Beach, US
★★★★★ 5
10/10 Great game changer for aggressive chewers
After a scary experience where our Doberman ingested part of a toy and needed emergency surgery, we had to get rid of all plush toys and small balls in our house. Replacing everything felt overwhelming. This ball has been fantastic. It’s truly built for aggressive chewers and holds up incredibly well. It’s perfect for fetch, strong enough for tug-of-war, and the bounce is excellent, which keeps our dog fully engaged during self-play when he’s entertaining himself. That unpredictable bounce makes it exciting without being unsafe. Most importantly, it gives us peace of mind. No shredding, no chunks coming off, no felt cover and constant worry about ingestion. Since having to replace all of his previous toys and balls, this one has stood out as the best by far. If you have a large, powerful dog—especially a Doberman—or a dog who destroys toys quickly, this is a must-have. Durable, safe, and genuinely fun. 10/10, highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
C
Verified Purchase
Crystal Knapp
Birmingham, US
★★★★★ 5
Finally, a sturdy oversized ball my boy can't destroy! And can pick up easily
This is just wonderful! My dog has destroyed all other balls! I think this is finally one he cannot destroy. And I love the holes so he can pick it up and throw it himself. LOL. And it BOUNCES, bringing him endless joy and skill in catching it. Cause you don't know which way it will bounce off the ground. Oversize was just right for him. Glad to have found this great sturdy ball.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
K
Verified Purchase
Kristi V.
Cuba, US
★★★★★ 4
Almost perfect...upraised logo should be left off
This toy is great for relentless chewers with strong jaws! It would be almost perfect if it didn't have a "K9" logo in raised rubber on it. That is the place that my aggressive chewer shepherd/bulldog mix focuses on and is able to get small chunks off. Without that logo, he would chew the ball more evenly, instead of fixating on that one spot. He loves this ball and has chewed on it for about an hour off & on each of the 11 days he has had it. Although it is very durable so far, the flaw is the upraised logo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
R
Verified Purchase
Ryan
Massapequa, US
★★★★★ 5
Perfect for High-Drive Dogs & Surprisingly Durable (six month review)
I use this ring ball for structured fetch and tug sessions with my high-drive German Shepherd mix (91 lbs. at 10 mon.), and it’s easily the best toy we’ve added to our routine. What makes it truly exceptional is how it allows my dog to engage in the full canine predatory sequence: • Chase: He locks in visually and bolts after the ring when I throw it. • Grab & Hold: He brings it back, pins it against my leg, and bites down firmly (the toy—not the leg!)—his way of acting out the natural catch-and-control behavior. • Unalive & Tug: We finish with a strong tug session, which satisfies his instinct to grip and shake—basically his version of “making the toy unalive.” • Settle & Chew: Afterward, he relaxes with a chew toy or eats—completing the full physical and mental cycle in a healthy, balanced way. Durability is outstanding—this toy stands up to intense tug sessions with no tearing or damage, even with a 91 lb powerhouse. My senior dog also joins in for double tug play, and it holds up beautifully to that too. I don’t leave this toy down for chewing—it’s not a chew toy. I use it specifically for fetch and tug, then put it away when we’re done. This keeps it exciting and extends its lifespan. My dog has other chew toys he can use freely throughout the day. This isn’t just another fetch toy—when thoughtful it provides a structured, instinct-satisfying experience that’s mentally enriching and physically engaging. If you have a high-drive or working breed, or a dog who thrives on interactive play, this ring ball is 100% worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025

recommand products