Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 10 - Jul 15
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD81, His TagProduct Specification Species Human Synonyms 26 kDa cell surface protein TAPA 1, Target of the antiproliferative antibody 1, Tetraspanin 28 (Tspan 28) Accession P60033 Amino Acid Sequence Protein sequence(P60033, Phe113 Lys201, with C 10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 4kDa Actual: 11kDa Purity 95% by SDS PAGE
Product Specification
| Species | Human |
| Synonyms | 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28) |
| Accession | P60033 |
| Amino Acid Sequence |
Protein sequence(P60033, Phe113-Lys201, with C-10*His)
|
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 11.4kDa Actual:11kDa |
| Purity | ＞95% by SDS-PAGE |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy